SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9Q0F8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9Q0F8
Domain Number 1 Region: 5-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.14e-70
Family G proteins 0.0000053
Further Details:      
 
Domain Number 2 Region: 463-623
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.08e-52
Family Translational machinery components 0.0000202
Further Details:      
 
Domain Number 3 Region: 256-371
Classification Level Classification E-value
Superfamily Translation proteins 1.35e-25
Family Elongation factors 0.0021
Further Details:      
 
Domain Number 4 Region: 624-717
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.23e-21
Family EF-G/eEF-2 domains III and V 0.0044
Further Details:      
 
Domain Number 5 Region: 386-461
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.4e-20
Family EF-G/eEF-2 domains III and V 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9Q0F8
Sequence length 731
Comment (tr|D9Q0F8|D9Q0F8_ACIS3) Elongation factor 2 {ECO:0000256|HAMAP-Rule:MF_00054, ECO:0000256|SAAS:SAAS00384494} KW=Complete proteome; Reference proteome OX=666510 OS=345-15). GN=ASAC_0389 OC=Acidilobus.
Sequence
MVSEIEKIMSNIEQVRNIGVIAHVDHGKTTTSDALLAGAGIISERVAGEALALDYLNVEK
ERQMTVKAANASLYHEYNGKGYVINLIDTPGHIDFTGMVTRSLRVLDGAIVVVDAAEGVM
TQTETVLRQALEERVRPVLYINKIDRLIKELRLTSSQLQDRLVEIIKDVNNLIDMYAEPE
FKDKWKLNPAAGNVAFGSAKDQWGITVPIASKKGINFQQIIDAYSSDDKDKIAALTKKAP
LHEALLDMVVKFVPNPKEAQKYRIPKIWKGDLNSDLGKAMLEADPNGPVVFYVNAIHVEK
AGLVATGRVFSGTLEPGKELYVVSQDVTGRVLQVSLYMGPFRELTQRVTAGNIAAIMGID
NLRAGETLVESQYKSQGAPFEQLHYIAEPVVTIAIEPAKVQDLPKLVDSLRKLTIEDPNL
VAKINEETGEYLLSGMGQLHLEIALWMLKEIYGLEVKASQPIIVYRESVREKSQVFEGKS
PNKHNRFYLSVEPLNDETIDLIHRGAVREDQDSRDRAKILKEQAGWDYDEARRIWAIDEN
INVFVDMTSGVQYLKDVKDTIIGGFRIAVKEGPLAAEPVRGIKVVLHDAEVHEDPVHRGP
GQIYPAVRNAIWAGILTSRPTLLEPIQKLDIRIPMEYLSAVTTIIVKKRGKIIDVENTPS
GTRVLAEIPIAESFDLAAELRGSTAGKALWGTEFSRWAPVPDSMLDDLIRKIRERKGLPQ
KLPSLSDLLGP
Download sequence
Identical sequences D9Q0F8
gi|302348189|ref|YP_003815827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]