SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9Q1V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9Q1V4
Domain Number 1 Region: 40-202
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000243
Family ATP-dependent protease Lon (La), catalytic domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9Q1V4
Sequence length 634
Comment (tr|D9Q1V4|D9Q1V4_ACIS3) Uncharacterized protein {ECO:0000313|EMBL:ADL19292.1} KW=Complete proteome; Reference proteome OX=666510 OS=345-15). GN=ASAC_0886 OC=Acidilobus.
Sequence
MSKGLAFLLASLIIIASLAATSPSVARAQQASWSRSTWILLPAVEGTSGVVTNTTITLSY
PGSGQVTVSDNTGPAQPSTLYSMETAFMVAMTYAGLNWRYYNLNVHINVSGQISGPSGSF
GVMLAVYTLATGLNDTYLHRFAITGAVSPSGLSGPIGGLPYKCEAASSNGLGIVYPVGNL
ETGIASCNDTDQVPVAGIVDALVKVLHSYRFNVTLSVEPLPMFNAVMENVATGFINESTS
LLHGVNLFDEPQPLQGEVEGYINASEQDIGLAEKFLKTLSYAAASYAFTAYINALAANYT
VWAYRAYQSGEGLSQFFSSQSSAITSEAESLIAQAVAYTNSSNGLAYDELAATAFARLAD
SIYYAGYASSISQEVNVSGAYLPAYYLGVAKARIQSAIGWLIAANATRGTGPLISPQFVA
STASSVGAFTDTAIRYANSLISYYVQEFESVGDIADAQVLQSMENDLSFLVSEGDHMLSQ
GYYLAAIGVYEDALTNALNVIFIETQSFSNPAVISAYARELEMEYSLLGSALSMRGLSSS
LDASYMSYATTLMPSDPQDAIYIMESAVVDELVWYIGAVGYSGGEPQAVSTSQSGPSLGA
TLALVLAAMAVGAMAVAAISLRSYKNYIRSVSRP
Download sequence
Identical sequences D9Q1V4
gi|302348685|ref|YP_003816323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]