SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9Q1Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9Q1Z8
Domain Number 1 Region: 9-182,341-424
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.83e-60
Family Bacterial dinuclear zinc exopeptidases 0.00053
Further Details:      
 
Domain Number 2 Region: 182-225,267-298
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.000000000000254
Family Bacterial exopeptidase dimerisation domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9Q1Z8
Sequence length 428
Comment (tr|D9Q1Z8|D9Q1Z8_ACIS3) Acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase {ECO:0000313|EMBL:ADL19336.1} KW=Complete proteome; Reference proteome OX=666510 OS=345-15). GN=ASAC_0931 OC=Acidilobus.
Sequence
MNVESLSMRLAKLTSDMIRIDTSNPPGHTREFVNFLVDYLQLQGFSPDTVEIAEGKPNLI
VKVGSGSPTLILNGHMDVVPAGDKGKWTKADPFSGEIKDDKVYGRGATDMKGGLAVIVAL
FSDVAKLIEDRGAGSLTLVASADEEVGGANGLGALVSRKVVTGDAAIIAEPSGVETISIG
EKGLCQISLTVKGRSAHGSMPILGDNAITKSLDVIELLSQAIDSYNSKIEPPKDLEEMLE
SSIDVLVEEASKSQVKISRSEAEYVLKKITFNPGVMHCGTKINVVPDRCDVEIDTRLPLG
VKGGGERTACELLLEDIRSILLENLPPDSFELGILNSSEPNYTDPNSGIVKVISNSIERV
LGVKPKYRIETGATDGRYLRYVGVPVAIYGPGEPFLAHAYNEYVKIEDLEKAYKVLRDAV
LSFFNVSE
Download sequence
Identical sequences D9Q1Z8
WP_013266848.1.78912 gi|302348729|ref|YP_003816367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]