SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9Q2K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9Q2K4
Domain Number 1 Region: 12-176,205-219
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.38e-54
Family Ribonuclease PH domain 1-like 0.00000259
Further Details:      
 
Domain Number 2 Region: 191-275
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.45e-20
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9Q2K4
Sequence length 280
Comment (tr|D9Q2K4|D9Q2K4_ACIS3) Exosome complex component Rrp42 {ECO:0000256|HAMAP-Rule:MF_00622} KW=Complete proteome; Reference proteome OX=666510 OS=345-15). GN=ASAC_1137 OC=Acidilobus.
Sequence
MSYTPYRVPIVSKIRSKSLISLYKKGVRSDQRDFATPRNLSIQVGVIDKADGSAWVKLGN
TQVLVGVKLEVGIPYRDTPNEGVLQVNSELTPVASPTFEPGPPDENAVELSRVIDRSLRD
PKAIDLSSLVIRPGEKAWVLWIDIYVLDYDGNYFDASMLGVMAALMNTKVPEYEETESGE
IIINREKGTPLKLNRRVALVTSVKVGDYILIDPNIDEELLADSRMVIAFDEQGTIVGMQK
SGMGGYTRDELLKVIDISRNASQVYFKLLDQALQSGGSQG
Download sequence
Identical sequences D9Q2K4
gi|302348935|ref|YP_003816573.1| WP_013267054.1.78912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]