SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9SQT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SQT2
Domain Number 1 Region: 40-78,105-519
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 5.35e-120
Family Cellulases catalytic domain 0.000000051
Further Details:      
 
Domain Number 2 Region: 555-703
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 7.85e-25
Family Cellulose-binding domain family III 0.00047
Further Details:      
 
Domain Number 3 Region: 714-775
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000889
Family Type I dockerin domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9SQT2
Sequence length 777
Comment (tr|D9SQT2|D9SQT2_CLOC7) Glycoside hydrolase family 9 {ECO:0000313|EMBL:ADL52288.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_2576 OC=Clostridium.
Sequence
MKKYGFFSKKTKSSIISAIVSSVLLSSVSTINTKAADLEFNYAKALQYSQFFYDANMCGT
GVNENGLYNWRGDCHTYDAKLPLDSKNTNMSDSFILANKTILDPDGDGTVDVSGGFHDAG
DHVKFGMPEAYSGSTLGWGFYEFRKQYEATGQDAHAKTLLRYFNDYFMKCTFLDSSGKAI
AFCYQVGDGDIDHAYWNAPEIDEMFRRGWFATDELPSTDVLAATAASLAINYMNFKDEDP
AYAEKSLKYAKALFQFAERSDTKKCNADGPKGYYGSSKWQDDYCWAGSWLYLATQDEHYL
NEVFKYYDYYAASCWTHCWNDVWAGTTCVLSEIDDLYDKDGQVLENKFRTAANKSPYEEI
NFWSQIAKTVDNWMTGKTVTITPGGYSFLNQWGSARYNTSAQLLALVYDKHHGNTASKYS
EWAKSQMQYLMGENPANRCYIVGYNDIAAKFPHHRAASGLSKCEDPASHRYVLYGALVGG
PGSSDEHKDVTSDYIYNEVTIDYNAAFVGACAGLYNFFGDSSMTVTPNFPPKASTGDDPS
TGGTSYWVNAFGVDIAQADGPKATEVTLFVGSDTRTPSKNISVRYYFDATGMSSLAADKI
EMRQLYDQAAAETTYKATLSGPKQYKDNIYYIEISWPGYAIANSNKKYQFALGTYAYQNY
WNPTDDWSHQGLSIESSNWTGTPVKTDHICVYDNGVLVGGTEPDGTTPSKPVTPTIIKGD
INNDGKINALDLAFLKMHILGTKTLTDNALIAADYDSNNAINAIDLIKIKKYILGQA
Download sequence
Identical sequences A0A173MZP3 D9SQT2
gi|302875419|ref|YP_003844052.1| WP_010075548.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]