SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9SRM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SRM3
Domain Number 1 Region: 36-439
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.44e-70
Family beta-glycanases 0.00000378
Further Details:      
 
Domain Number 2 Region: 484-542
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000017
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9SRM3
Sequence length 544
Comment (tr|D9SRM3|D9SRM3_CLOC7) Glycoside hydrolase family 5 {ECO:0000313|EMBL:ADL50390.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_0619 OC=Clostridium.
Sequence
MKRLKKLTSIVASLMVASSFCFSTTQVKAAVDTNNDDWLHCKGDKILDKNGNEVWLTGAN
WFGFNCSENVVHGSWYDVKNLMKSIADRGIGLIRIPISSELLCSWMNGTPNPTSSVSADN
SPYHTINADFYDPATKGTKDSMQIFDIMMGYCKELGIKVMVDVHSPHADNSGHTYPLWYG
LETKTAGVITTDKWIDSLTWLVDKYKNDDTILAVDLKNEPHGKRNYKAEIPTDMAKWDDS
TDENNWKYAAEKCSKSVLAANPNILVMIEGVEQTPKYDKGFTYATPDIWQSSDADSPYVR
GWWGGVLSGVKKYPINLGDLNSQVVYSPHDYGPSVYNQVWFDKDFTRQTLLDDYWYNAWA
FIDDQGIAPLLIGEWGGHMDGGKNQKWMELLRDYMIEKRINHTFWCINPNSGDTGGLIGY
DWTTWDEAKYGLLKPALWQDKGKFIGLDHQVKLGSNGMSLNEYFNLTPTDPTDPTDPTNP
TEPIVLPGDVNGDKVVNAMDYAILKKYLLNGSSVTINQANSDLNGDSKVNAIDFAKLKLL
LLSK
Download sequence
Identical sequences A0A173MZX7 D9SRM3
WP_010074830.1.47838 gi|302873521|ref|YP_003842154.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]