SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9SS53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SS53
Domain Number 1 Region: 493-735
Classification Level Classification E-value
Superfamily Kelch motif 4.9e-33
Family Kelch motif 0.0021
Further Details:      
 
Domain Number 2 Region: 21-308
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.21e-19
Family Papain-like 0.012
Further Details:      
 
Domain Number 3 Region: 943-1013
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000183
Family Type I dockerin domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9SS53
Sequence length 1018
Comment (tr|D9SS53|D9SS53_CLOC7) Peptidase C1A papain {ECO:0000313|EMBL:ADL52500.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_2803 OC=Clostridium.
Sequence
MKRTKKMVKAILTCAMVVTMVFPNVQKVFAENSAFILNEGEVLPRSVDNSELPFFPVISD
QGALGSCSTFSQTYYQATYMNGMAKGLDVKNSTDGSNILSTKWTYNFANGGQNRGAYGMD
CFMEQGVPTNKEFPYDGSGAEQSYREWSVNENTWKNAFSNKVDKFGILSINDGTDTPVKS
VNDSTLTKVKEALSKGYVLTTDIDIFDLKYLPVKDNNTTTNDDKYIGQAAVGISEDTADK
PRHAITVVGYNDDIWVDINGDNVRDVQEMGAFKIANSWGKAWGTDFDPLDGESTKSGFVW
VSYDAINTVSLLPNVPTSEYKRKSVFGSFTWMTMKSTNTPYLIAAIDIMHQERNQLQYEI
GYSDINETEPTVTYKPKTVNADNGSCTFNGLSGTEVAGKILIDYSNLIRLSNFTNGEKKW
YVKITDTKVDGLSGKNISFKLIDPVTKSETFAVQGATVDGNSITLSMNYQLSPINNPATK
WAYKKGINNEDYNFSSNTVSYGNKIYTYDMVNHDLVQYDTDTSSWSVYDQTWPELSSISK
MVCINGKIYVFKTNSIYTVDTINSLDVYDIQSKTWETKQAMPQYRLGAAVSACNGKIYVT
GGKVCTFIENTSRRRVSLTNEILEYDPISNTWITKTSNLMYRQNASTAVGDGKIYHITGN
NGSGDIYTVEEYDPMNNTTTIVKDIPKEVPIGMTTKMAANNEKICLMYSNFTIYNSTFNP
VIYEYNMKDNSWTKQYEEQTIETIKDIKECNGKIYAFAEKSNNILQYDPAVQVTSNNVEK
VGLPYFSLLSGKYDTEQTIKIKCSTSGATIRYTTDGSTPTINSNEYKEPITISADTKIRT
IAVKPGMENSYVNFVDYKIGEILQAPVFTLSDGSYREGKKLTMTSLEPYTSIKYTTYGSI
PTVTSDDYKGPIYIIGNVIVKAIAIRNDGEVSSVASNFYKVKSVIGDLNADGKVTAMDLL
AISTYINDPSYNFLIEDYLWGGDVNGDGLINTEDKTLVLNYIKGIITSFPKEQQLGLV
Download sequence
Identical sequences A0A173MZP9 D9SS53
WP_010076694.1.47838 gi|302875631|ref|YP_003844264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]