SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9SS66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SS66
Domain Number 1 Region: 310-811
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.15e-117
Family Cellulases catalytic domain 0.00000000178
Further Details:      
 
Domain Number 2 Region: 43-195
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.14e-35
Family CBM4/9 0.0039
Further Details:      
 
Domain Number 3 Region: 209-307
Classification Level Classification E-value
Superfamily E set domains 1.54e-23
Family E-set domains of sugar-utilizing enzymes 0.00063
Further Details:      
 
Domain Number 4 Region: 819-875
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000497
Family Type I dockerin domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9SS66
Sequence length 876
Comment (tr|D9SS66|D9SS66_CLOC7) Glycoside hydrolase family 9 {ECO:0000313|EMBL:ADL52513.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_2816 OC=Clostridium.
Sequence
MNRKKITAYATAIVTVLSIPTVATSVVTSKSVSAATNFDYREIIANNTFDNNNATPWTLV
QNYPAIAKMVAKDGKCSVTVLNDGVEGRWDVQLRHRGIVLEQGHKYRVRFTVTADKDCYI
YPKIGDQGEPYREYWNYNSYQRIQLKAGVPTTVDQTFEMKDPTAKTAEFAFHLAGDCKAA
TFPYTFTFDDIYLTDPNRIPPPPPPEEPTNAVRVNQVGYFTNLQKKATVVTKATSPITWY
LKNSAGVQVATGETKVLGADAASGDNVHIIDFSNYTTEGSDYTLSVDQSNIDSLICNSAS
SLPFAIGKELYNKLQKDAMKYFYLNRSGIPITMPYAERTDLTRVAGHTLDVIATDASSTD
PSPWYKENYSLEVTGGWYDDTRYNKSVINGSISAWTIMNQYERALKANKVSVIPFADNTM
NIPESGNGYPDILDEVRFQMEMMMKMQIPAGKTYSGMVHHRAKDERWIPLATRPDQDQMK
RYLEPPSTAATLDLAATAAQSSRLWAKYDSTFANQCLVSAETAWAAAIKNPAIYAPLQSS
FSGTYGDTNIADEFYWAAAELYETTGKQQYLDYLKNNCQDKFLKIPTKIVGGEANGVSGC
FDSGDVTGLGTISLAIGDKLDVASKTTARANIAAAADVFVANTQKEGYGTPMDQGIVGQV
VDQNGYVTKPIEGYPYASNSYVTNEAIVMGYAYDFTKNRNYLNGVVSAMDYILGRNPMVQ
SYVTGYGSNPVENPHNVFWAYQYDNTFPKAPAGCMASGPNSGLQDSWVKASGWTPGSRPA
AKCFMDNIESWSTNDLSNSYNASLAWVSSYVNLNSLPESIKGDINNDAKINAIDLALLKK
YILNNDIPIVAINGDINGDGIINAIDLLLLKKQLLA
Download sequence
Identical sequences D9SS66
gi|302875644|ref|YP_003844277.1| WP_010074610.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]