SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9SS67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SS67
Domain Number 1 Region: 102-408
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.35e-62
Family beta-glycanases 0.00011
Further Details:      
 
Domain Number 2 Region: 27-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.57e-17
Family Type I dockerin domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9SS67
Sequence length 425
Comment (tr|D9SS67|D9SS67_CLOC7) Dockerin type 1 {ECO:0000313|EMBL:ADL52514.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_2818 OC=Clostridium.
Sequence
MKRRILSILTAALVTATIIPFSASAATTLGDVNVDGKVNSIDMAIVKQYILGTKTFSDAE
LKAADVDANGKVNAIDLALYKQYILGSITKFPGDKGVVDNRTTTGPGITWMDGYKLFPVG
VNYGWNNWCYEFSDSNWDTNFAKMKSDMDAMNLKGVKSLRWWVFPDLAFGPTWSGTGKGS
LCTGLPNNWVNHMKAVCDYALTKNIKIYWTLTSFDAARQDGTDHHSDIFTNEAVRQSFFD
NAVKPIVTALGNHEAVMGWDCINEPEWIIKKEDNGEPKASGYDIYALSDIRNYVQSTTAL
IHQYAKQPVSVGSASMKWSGAQFSLWTGLGLDFYDFHWYDWATPWFNPMTTPASSLKLDK
PVIIGEMMSDTLSSSLKVDHKVVMDAIMANGYSGYMTWAWNDGSCGNFIGSNFTNFGAQH
TDIVR
Download sequence
Identical sequences D9SS67 Q9LAJ3
gi|302875645|ref|YP_003844278.1| WP_010074612.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]