SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9SS72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SS72
Domain Number 1 Region: 35-665
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 7.29e-301
Family Cellulases catalytic domain 0.000000000000112
Further Details:      
 
Domain Number 2 Region: 670-726
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.97e-16
Family Type I dockerin domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9SS72
Sequence length 727
Comment (tr|D9SS72|D9SS72_CLOC7) Glycoside hydrolase family 48 {ECO:0000313|EMBL:ADL52519.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_2823 OC=Clostridium.
Sequence
MRKRLNKIVAVALTATTISSVAATVNTAQVSAAPVVPNNEYVQHFKDMYAKIHNANNGYF
SDEGIPYHAVETLMVEAPDYGHETTSEAFSYYMWLEAMNAKLTGDFSGFKKAWDVTEKYI
IPGETDQPSASMSNYDPNKPATYAAEHPDPSMYPSQLQFGAAVGKDPLYNELKSTYGTSQ
VYGMHWLLDVDNWYGFGGATSTSPVYINTFQRGVQESCWETVPQPCKDEMKYGGRNGFLD
LFTGDSQYATQFKYTNAPDADARAVQATYYAQLAAKEWGVDISSYVAKSTKMGDFLRYSF
FDKYFRKVGNSTQAGTGYDSAQYLLNWYYAWGGGISSNWSWRIGSSHNHFGYQNPMAAWI
LSNTSDFKPKSPNAATDWNNSLKRQIEFYQWLQSAEGGIAGGASNSNGGSYQAWPAGTAT
FYGMGYTPHPVYEDPGSNEWFGMQAWSMQRVAEYYYSSKDPAAKSLLDKWAKWACANVQF
DDAAKKFKIPAKLVWTGQPDTWTGSYTGNSNLHVKVEAYGEDLGVAGSLSNALSYYAKAL
ESSTDAADKVAYNTAKETSRKILDYLWASYQDDKGIAVTETRNDFKRFNQSVYIPSGWTG
KMPNGDVIQSGATFLSIRSKYKQDPSWPKVEAALANGTGVDMTYHRFWGQSDIAIAFGTY
GTLFTDPTPGLKGDVNSDAKVNAIDLAILKKYILDSTTKINTANSDMNGDGKVNAMDLAL
LKKALLA
Download sequence
Identical sequences D9SS72
gi|302875650|ref|YP_003844283.1| WP_013291798.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]