SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9SST3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SST3
Domain Number 1 Region: 188-534
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.15e-81
Family beta-glycanases 0.00000289
Further Details:      
 
Domain Number 2 Region: 31-181
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2e-35
Family CBM22 0.00081
Further Details:      
 
Domain Number 3 Region: 544-606
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.44e-16
Family Type I dockerin domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9SST3
Sequence length 607
Comment (tr|D9SST3|D9SST3_CLOC7) Beta-xylanase {ECO:0000256|RuleBase:RU361174} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_2900 OC=Clostridium.
Sequence
MNLSKRLLSCVLSAGIVASAFAVATPVYAEDALLISSTFEGGTDGWSTMGTTTISPSTLS
HSGNGSLYVSGRAASWAGPCNIRTDVLKAGNTYNLSSYVMYNDASAADTQPISFMLKYTD
STNKAFYVPIATVTVNKGEWTKIENTAYKIPAEATSAMIYWETTGTMINYYVDDVTAYGP
STFNPNVTAATPLKNVFGKYFDIGCAATPSEVSLQVAKDLVKTHYNNLTIGNELKPDYVL
DKAACQASGNNVNPQVKLDSARSLLKYCAENNIEVRGHVLVWHSQTPSWFFKENFSDTGA
TVSKDVMNQRLENYIKNLFAAINAEFPTLKIYAWDVVNECYLDGGNLRTAGFPETAGKEA
SAWNLVYGDDSYIDNAFTYARKYAPAGVKLFYNDFNEYIQSKRNAIYTMAMRLKSKGIID
GIGMQSHLDMGFPDTNTYKAALTKFGSTGLEVQVTELDITTSDTSATGLANQATKYAAIM
QSILDAKKAGTANITNVVFWGITDGTSWRATRLPLLFDGNYYPKPAFDSVVKLVPTSDYY
TPGYALGDVNNDGKINALDLALVKKGLLSEFTDPAAKVAADVNKDGNTNAIDLALLKKYL
LGQITSF
Download sequence
Identical sequences D9SST3 Q6J286
WP_010075688.1.47838 gi|302875726|ref|YP_003844359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]