SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9ST97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9ST97
Domain Number 1 Region: 529-634
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.91e-19
Family Histidine kinase 0.0063
Further Details:      
 
Domain Number 2 Region: 67-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000357
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9ST97
Sequence length 640
Comment (tr|D9ST97|D9ST97_CLOC7) Signal transduction histidine kinase, LytS {ECO:0000313|EMBL:ADL50713.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_0945 OC=Clostridium.
Sequence
MLLYSKIHYLLYEKNKFLVLKTTLSIFIIVLMSVVFSGCTEHQSTDKKPPKAINGKFELS
DWDFQKEGAILLNGQWEFYWNKLLYPEDFNQSTVSHKNHIVAVPTSWRNYQIEDKKLPNE
GYATYRLLVDLDYIPQDLAINTKAFISTCRIWVDNKEIFQTGVVSDNPNTSKDRFKPQLI
TIHPQNKQFYITVQISNFGCAYGGFVTGLELGNIHLLNNENNKQAYVDMFLFGSILIMGL
YHITLYLLRRKDCSTLYFGIICLLIAIRTLLMGQMLLYSFLPSVPLHIFLKLSMITLYLA
LTFFVMFIHIVFPLDTPRWFVRFSQAIGLFFFTTAIIFTEKLGNLFIVPYEIISVFILIV
LLSVLIKAFLKKRESSILVLSAVLFIILIAINDILNSYGVISTGFFIPFGVFIFIFVQSF
MLSRKFAKAFFHEEQLLKSELRMLQAQIKPHFLFNTLNTIICVCRESSEKAEELLLNLSN
YLRCGFSFKNDDEFADLETELLHVKSYLHIEKARFLDKLNIIFDIDTNIHCKVPAYIIQP
IVENSVRHGILPCKDGGTVRLTVKKNNNMLIIIVEDDGVGMTEEKLTALLNSSDKKAGIG
ISNIQNRIQRIYGKSIKIKSTKGIGTIVTLELPLSDALNL
Download sequence
Identical sequences D9ST97
gi|302873844|ref|YP_003842477.1| WP_010076442.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]