SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9STD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9STD3
Domain Number 1 Region: 38-416
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.3e-61
Family beta-glycanases 0.00000881
Further Details:      
 
Domain Number 2 Region: 475-531
Classification Level Classification E-value
Superfamily Type I dockerin domain 7.85e-16
Family Type I dockerin domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9STD3
Sequence length 532
Comment (tr|D9STD3|D9STD3_CLOC7) Glycoside hydrolase family 5 {ECO:0000313|EMBL:ADL50749.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_0983 OC=Clostridium.
Sequence
MKKIMKLSTTAIALTSLLVTPSIKVCAETTTPVAETNDDWLHVEGTNIVDKYGNKVWLTG
ANWFGFNCRERMFLDSYHSNIIADIEMVADKGINVVRMPIATDLLYAWSKGEYPESTDTS
YNNASLAGLNSFQLFNFMLQNFKRVGIKVIVDVHSAETDNMGHSYPLWYKGAITEDVFKS
SWVWFADQYKNDDTIIGFDLKNEPHTNPGDAKNLSQCAIWDDSTKANNWKRVAQETALDI
MNVHPNALIFVEGVELYPKDGTWDEGTINTSPWAGNNDYTSNWWGGNLRGVKDYPINLGE
YQKQLVYSPHDYGPLVYEQSWFKGDFVTADDATAKTILYEKCWRDNWAYIMENGTSPLLI
GEWGGLTEGTDKLLDVNLKYLRSMRDYIIANKYKLHHTFWCINTDSSDTGGLLTRGEGTA
FPGARDLKWNDNKYDNYLLPTLWRNDEGKFIGLDHKIPLGKNGITLGTSIVINPPLLGDI
NKDGKVNAIDLAVLKKALLGTGTTPDLAVADMNNDGKINAIDLAVLKKKLLS
Download sequence
Identical sequences D9STD3
WP_010076404.1.47838 gi|302873880|ref|YP_003842513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]