SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9STT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9STT6
Domain Number 1 Region: 771-840
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.3e-18
Family Type I dockerin domain 0.00088
Further Details:      
 
Domain Number 2 Region: 133-426,524-573
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00000000000000157
Family Integrin alpha N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9STT6
Sequence length 840
Comment (tr|D9STT6|D9STT6_CLOC7) Dockerin type 1 {ECO:0000313|EMBL:ADL50774.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_1010 OC=Clostridium.
Sequence
MLKKALLSVFMGAAVLLGSIAPQTITTTAATARQMENLDRGVVAVKVSNGVFVSWRVLGT
EATNVSYNLYRDSVKVANITGASNYIDASGTTTSKYSVSAVVNGVEQSKSTAVSVLGNNY
MQLPLQIPAGGKTPDGVAYTYNANDCSVGDLDGDGQYEIVLKWDPSNSKDNSQKGYTGNV
FLDAYEMNGTRLWRIDLGKNIRAGAHYTQFMVYDLNGDGKAEVACKTSDGTKDGVGTVIG
NASADYRNSSGYILSGPEYLTIFQGSNGKALNTINYEPGRGTVSSWGDSYGNRVDRFLGC
IAYLDGVHPSLVMCRGYYTRAVLVAYDWNGSTLTKRWTFDSNTSGNSGYAGQGNHNLSVA
DVDSDGKDEIIYGGCTIDDSGKGLYTTGLRHGDALHVSDLDPSRHGLEVWSCHEDTSGNG
GIGGSFRDAKTGQVLWSFKAANDTGRACSADVTAAYPGEEVWASGSSLYSSKGENIGNRP
GPVNFAIWWDGDELRELLDDTTISKYGGGNLLSVSDCDSNNTTKATPCLQADILGDWREE
VIWRTTDNKYLRIYTTTATTSRRIYTLMHDPVYRMGVAWQNVAYNQPPHTGFFLGSGMST
PPTPAIKLVGATTPTNPTAPTTILDGQYIKSLVVKDTNNASDWSIQSNLKVGDPVYGDRT
NKFTVIPSKLLGSEWIRTACDSKTYTSDLASFTTKSDVSVYVGIDARISSIPAWLSSWTN
TGETLTNDSDVTFNLYKKDFSTNSNVVLGTNSASSSAVNYTAIVVKNTPSSLIYGDVNGD
SAVNAIDYAFMKKYLLGTTTSMPSPNWQKVGDLNSDGVINAIDYAYLKKYLLGSITKLPV
Download sequence
Identical sequences D9STT6
WP_013291638.1.47838 gi|302873905|ref|YP_003842538.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]