SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9STU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9STU8
Domain Number 1 Region: 493-525,570-838
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 4.62e-52
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000915
Further Details:      
 
Domain Number 2 Region: 171-236
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000145
Family Family 27 carbohydrate binding module, CBM27 0.022
Further Details:      
 
Weak hits

Sequence:  D9STU8
Domain Number - Region: 259-317
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0198
Family Family 27 carbohydrate binding module, CBM27 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9STU8
Sequence length 840
Comment (tr|D9STU8|D9STU8_CLOC7) Methyl-accepting chemotaxis sensory transducer {ECO:0000313|EMBL:ADL50786.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_1023 OC=Clostridium.
Sequence
MKKDYGYNKLQNYIKSKASQSIKGKLFVMCLVSVICIMLLGITSLVILSRNGNDYIVTTN
MNKINLIQYENKSINTNYLYSFDNALLEQIESNLGEILEIAEETQSLATGTNKSDINQII
DLAQKNITNLKEIIKLNDSRGFTNEEGKFKEFLANDEAISKTLEKTIADKSWVDLSMGDI
SSFANGTVVIDNKQYNKVTYVSNIPNSGKRLEIIPRIGGNGVEYKGTVYINNIVLENGSK
KQQIDLGKYKDDDLKNSYGFALSSFTLSKLNNNPSIEIKSNFTKANNKWEEIDIKLPASD
IDTQDYSKISYDVYFEAGSIQGLSAGMAMNNLYDFVESFNSIVSNIDMYNKLVAEGSDVQ
ASLDEIAKLFEEIKTNFPIYLHDDTIIQNNLGKIINKQNTFNEITESDKELLEFKSINNT
LEEDSTTLISTVKENIETKMNTRKTFMLILVTTLLIISTLVIGFITFAIKNSIYDNMKQF
SKILDEVADGNLLSRSKTKSMDEFSIFSKKLNEFLDKLSSILGSVQRLSDEVESKNNIIA
NIIRQVVKGNEAGDDIVVKKGILQLEKLFGEISESVATQSANTEESLAGINEILDLNEKV
LADITNTKEVSQETLLKVKDGHNGITSLNEKIEYINTSVFNTNEEIKELINNAKSIEEIL
VSIKSFSGQTDLLALNATIEAARAGMEGRGFAVVANEIKNLSQQTSNETQKINAIIESIN
NRIYKVQIANNEVVNSIKYALETTNYFKDIMNEVTTSTEFNFDSINKLFQTIKEQNNCMN
QISNAVEQISEEALSIQEKTANTTAITTELSSTLVNNLEEVEGAIRNSKQLKDDMNFFKI
Download sequence
Identical sequences D9STU8
gi|302873917|ref|YP_003842550.1| WP_010076365.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]