SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9SVH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SVH1
Domain Number 1 Region: 62-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-19
Family CBM4/9 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9SVH1
Sequence length 205
Comment (tr|D9SVH1|D9SVH1_CLOC7) Carbohydrate-binding CenC domain protein {ECO:0000313|EMBL:ADL51095.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_1342 OC=Clostridium.
Sequence
MGLQFMKKKFKTAVAAVVLASSVTGYNIAKEDDIVALDLKKSSLESMDYSKEKIEDISEN
LVKYGTFSESPECFKHWRVVVDNIAICTYENSNDVFSLEPEDCGNSEDAIQLCQTIDNIE
PGKKYTLNFKAKSTLPKSITVFISDRMDVLSFSKPATYSISDKWTDYTYDFVVSENTEPL
SVLRFYLGRTMGKISFTDIKLNLSS
Download sequence
Identical sequences D9SVH1
WP_013291664.1.47838 gi|302874226|ref|YP_003842859.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]