SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9SW41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SW41
Domain Number 1 Region: 13-385
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.16e-67
Family beta-glycanases 0.00000153
Further Details:      
 
Domain Number 2 Region: 396-462
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.02e-19
Family Type I dockerin domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9SW41
Sequence length 463
Comment (tr|D9SW41|D9SW41_CLOC7) Glycoside hydrolase family 5 {ECO:0000313|EMBL:ADL51185.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_1432 OC=Clostridium.
Sequence
MKKIKKNAARFAASIMTAGLAMSYSTAITKAETTTIDKYNVRNITTGQVVQNMGLGWNLG
NTFDAFGTWINGTKVSDYETAWGAPITTKAMIDGVRKAGFSSMRLPVAWSNLMASDYTIN
AGLLDRVEEVANYALDNNMYVIINIHYDGGWFSGFSTDYDTNIKKYTSVWTQITSRFAKY
GDHLIFESLNEEGCFNDIWNRWGGTTGKDKAFGILNNINQKFVDIVRASGGNNAKRHLLI
AGYATDIDLTCDPYYKMPTDPANRCAVSVHYYNPSPFAVLDADADWAKAQTTWGTASDLA
DLANYMNKMKTTFSDKGIPVIVGEYGVAQKNKTPEMVRLFLTSVAKEAYKNGLCPMLWDG
PGPQNVVYNRTTCQMNDSELAAQYKAIPQTVTRVNQINYGDINKDKNVNALDLALMKKYL
MAPNTTSDTKVMDVNGDGAVNAIDLAYLKKYLLGQITVFPVQA
Download sequence
Identical sequences A0A173MZN5 D9SW41
gi|302874316|ref|YP_003842949.1| WP_010075948.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]