SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9SWK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SWK5
Domain Number 1 Region: 539-642,672-871
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.65e-70
Family Putative acetylxylan esterase-like 0.0065
Further Details:      
 
Domain Number 2 Region: 42-221
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.44e-17
Family Family 27 carbohydrate binding module, CBM27 0.0015
Further Details:      
 
Domain Number 3 Region: 928-993
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000196
Family Type I dockerin domain 0.00049
Further Details:      
 
Domain Number 4 Region: 240-356
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000372
Family Family 6 carbohydrate binding module, CBM6 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9SWK5
Sequence length 995
Comment (tr|D9SWK5|D9SWK5_CLOC7) Uncharacterized protein {ECO:0000313|EMBL:ADL53287.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_3615 OC=Clostridium.
Sequence
MIKKLNIKKMVSLFMSAAVITTMISIPTIKTYAAEDEKLLYTFDDSTTMGWNVVNPAANG
GAFDTNVSAPIEYSEDLKMDGNDGALKINANFTNKTWDDASVMVNLGATGEDFSAYDTLD
YDLFVPTNFDKKLIIGTAGMDSSWKWQDDLFTSDYSGIDLNSGEQTTISGKAYNKLHVTR
SKTKAFDSLSDKTFMAFIIKIATTATTYCGPIYLDNIAISKGGYDPSAIPSKSGKDNICL
EAENGTLTGLNITKDSSASGESYVQGFDAPGDTLKVTADIQISGSYAVVIRYKTFGGDKS
NPVYLNKTKVKDCSFKQTDQWKDVIVGPLKLKAGKNEFSIGVSWGWIAVDYISFIGGDGK
QVSKVDLSTSTTSSQPCDIPVNFTAVADDAAQYRFEVKKVDGEWKEISKYSSSLSCVWVP
GTAGDYEIKVTARGLSLIDTQAEQTIKYTALPAYENKPLVNQMFGSGMVLQRDIDNAIWG
WAKHGTNVTVTIGTETFTGVSDIDGKWKIGIGKHSAGEPYNISVVAGVETVNITDVLFGD
VWLCSGQSNMAFTLKEAAEAANEIQNSNYPNIRYYTVPMKTSPAPVATMENPEGWKVCSP
STSSNLSAVAYFFARKLNKDLNVPIGVVFSAVGGTKAEEWTSYESLQTMPEYVDSSNEIK
TGTADIDIISSPTVLYNGMIAPVVPYGLKGVLWYQGESNWGESTYNKLLPTLISDWRKNF
GIKELPFILVQISAYGTLQSETNIVQNWNGLAEIREAQLKTMLSDKNVGLVVTTDVGDPA
NIHPTNKQDVGLRAALSAEKKVYNQNIIYSGPIYKSMVVEGNSIKISFDSIGSGLMVGLK
QGLTPAVEVKDGKLTGFAIAGSDNVFYLADAVISGDTVVVSSSKVTNPTAVRFGWADSPV
TNLYNKEGLPASTFRTDTTYIRVAEDIPTVLYGDINKDGKVNALDFALFKKFLLSSSGTY
DTILDLNKDNSVNAVDFAILKKYLLGGISSLPYVK
Download sequence
Identical sequences A0A173MZN8 D9SWK5
WP_010073619.1.47838 gi|302876418|ref|YP_003845051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]