SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0CP77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0CP77
Domain Number 1 Region: 106-200
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-21
Family B3 DNA binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0CP77
Sequence length 217
Comment (tr|E0CP77|E0CP77_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CBI19534.3} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_18s0001g10710 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MVAAKLTYEECRRKRLEENNKRLQALNLPLLSQALRESLTPKSSPAKNSKPRRVREQQVP
LRRSSRVANKAYQAQKEGRDLSNRVYASEEARTCAMERAEELQASLEPQYPSFLKSMLQS
HVTGGFWLGLPVHFCKTTLPKSDVIMNLVGEEGDEYPTVFLARKSGLSGGWKRFSVAHKL
VDGDALVFQLVRPTKFKVIIELHCRLSTFIIPTMEYF
Download sequence
Identical sequences E0CP77
GSVIVT01009519001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]