SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0CV58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E0CV58
Domain Number - Region: 3-28
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0785
Family Hairpin loop containing domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E0CV58
Sequence length 270
Comment (tr|E0CV58|E0CV58_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CBI23019.3} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_16s0098g01730 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MASTTKCRVLCTRVLQIFCRAFEFPQQNGLVYPMDRVFEYDPSLFSYQTNYNLPNFVDLR
ELEDHFLFLDQNLPSCNGVSIHDHPDDFDHYLEVGSEEHLTQLPSGNDSEDRLKIGGGFS
DLQSVIHGGFSGSWKHEEGTQQSSRSKTAALEMDDIKQYFNVPITRAAKELKVGLTVLKK
RCRELNITRWPHRKIKSLKALITNAKVLNKTRELGLTEEIEMLEEHRRMLEKQPEMELTE
KAKKLRQACFKANYKRKRALQAPFTQISYE
Download sequence
Identical sequences E0CV58
GSVIVT01038562001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]