SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0CW13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0CW13
Domain Number 1 Region: 211-262
Classification Level Classification E-value
Superfamily PapD-like 0.00000131
Family MSP-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E0CW13
Sequence length 348
Comment (tr|E0CW13|E0CW13_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CBI23402.3} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_00s0287g00080 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MNSNFNLSWTNKVIVILKLSTTQNITLLLRSKPHHLRSTLFDPIPGVIQPWDACVIXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDMQCKDKFLLQSTIVPPHTDLDELPQDAF
NKDSGKVIEECKLRVVYTLANRNSGDGSFASSNENADYNSNPTLQSLKEERDSAVRQTQQ
LQQELELLKRRRYPKSSGFSFRFALLVALIGIMVGFLLNLSLSSPSTE
Download sequence
Identical sequences E0CW13
GSVIVT01005720001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]