SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0SQJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0SQJ2
Domain Number 1 Region: 4-74,165-338
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.43e-79
Family Pyruvate kinase 0.0000191
Further Details:      
 
Domain Number 2 Region: 321-468
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 6.8e-22
Family Pyruvate kinase, C-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 69-165
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.0000000000000611
Family Pyruvate kinase beta-barrel domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0SQJ2
Sequence length 469
Comment (tr|E0SQJ2|E0SQJ2_IGNAA) Pyruvate kinase {ECO:0000256|RuleBase:RU000504} KW=Complete proteome; Reference proteome OX=583356 OS=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1). GN=Igag_1446 OC=Desulfurococcaceae; Ignisphaera.
Sequence
MFVKIIASIGPSSGNIETICNMVKEGVRGFRINFAHGDQSEWKKYVEAVREVEAKLGKPI
ALIGDLEGPSLRLGKISKPIVLQKGEHIKIIYGNEVSDSNEKNVPMPIPKFFEYIDVGDI
LIMDDGRTRLRIVDKGADSVEAIALTDSVITSRKAIAIQGKELDLPALSDRDINSIKFAI
ENDFDYIGLSYVRTAEDIDLLRDILRRAGREDIGIISKIETKSAIRNLSSILEKSDIILV
ARGDLGMNFGLEEIHYHQRYIVEKALENRKPVIVATQLLESMTEKPVPTRAEVVDVSVAV
EMGVDALMLTGETAVGKFPVEAVSWLNRIVVFVERHIMPKIIDRVSNKAREHLETIQLKF
AKGVLELAEDLSAKLFVFSIHGNTARRIAALKPKIPVYVASQNIKVLRKLSILWGLSPFH
INANSYEEGLQNMLSKAMDLKLISYGDLVVLTYGLKEPRQKVEILRIMS
Download sequence
Identical sequences E0SQJ2
gi|305663840|ref|YP_003860128.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]