SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0SQX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0SQX7
Domain Number 1 Region: 10-175,206-220
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.23e-49
Family Ribonuclease PH domain 1-like 0.00000377
Further Details:      
 
Domain Number 2 Region: 192-278
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.53e-21
Family Ribonuclease PH domain 2-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0SQX7
Sequence length 286
Comment (tr|E0SQX7|E0SQX7_IGNAA) Exosome complex component Rrp42 {ECO:0000256|HAMAP-Rule:MF_00622} KW=Complete proteome; Reference proteome OX=583356 OS=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1). GN=Igag_1505 OC=Desulfurococcaceae; Ignisphaera.
Sequence
MSSTQEQPIIPKIKYNAILGILNKGFHVDRRPLTSYRSFEVKFNIAPNADSSVLFKLGNT
QILAGVKLEVGQPFPDSPNEGILIVNAEYLPAASPTFEPGPPDENAIELARVIDRGLREA
KVIALDKLVIVPGKRVWIVWLDIYILDHDGNLIDASAMASMLALATTFIPYYEVDPLTSN
VKIDRTRKLQRLPLNRYVVSVTVNKIGDLLVIDPTGEEEAIASSKLAISISEEGNIVGIQ
KMGIGYVTEDDINKAIDIALSIGIDNIEKLKKIINQWEQTFLSATQ
Download sequence
Identical sequences E0SQX7
gi|305663899|ref|YP_003860187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]