SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0SQY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0SQY1
Domain Number 1 Region: 7-111
Classification Level Classification E-value
Superfamily Prefoldin 6.28e-23
Family Prefoldin 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0SQY1
Sequence length 119
Comment (tr|E0SQY1|E0SQY1_IGNAA) GimC subunit beta {ECO:0000256|HAMAP-Rule:MF_00307} KW=Complete proteome; Reference proteome OX=583356 OS=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1). GN=Igag_1509 OC=Desulfurococcaceae; Ignisphaera.
Sequence
MAETLPPEIQQQVVKYQQLQTQLNQVLSEKSIIEQELREINRALDILKNVPDDADIYRSA
GHLLVKINKSDAEKELTERKEILELRLKTLGRQESLLRQQLAEIQSKLNQYIASTYKRM
Download sequence
Identical sequences E0SQY1
gi|305663903|ref|YP_003860191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]