SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0SS76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0SS76
Domain Number 1 Region: 13-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-17
Family GHMP Kinase, N-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 206-251
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000000326
Family Galactokinase 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0SS76
Sequence length 268
Comment (tr|E0SS76|E0SS76_IGNAA) Shikimate kinase {ECO:0000256|HAMAP-Rule:MF_00370} KW=Complete proteome; Reference proteome OX=583356 OS=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1). GN=Igag_1736 OC=Desulfurococcaceae; Ignisphaera.
Sequence
MYAYGGVTIVNAVPAWLGSAMAIDLRVRVYVDICRPTEICYYQSKLVEYIVKYFMKKYNI
PRIKVYISSEIPPSSGLKSSSAVSVALIRCITSRFSIYEPSIPRLAAELSRLAGVSFTGA
LDDASASYYGGIVFTDNLNMNILKVLDLPKEYTTVLLFHATRNPVDVDRLRRCAYMFRDI
FELAYQGEIFRAMTMNGLLIARLLGYNEDIPRKALEKGALAAGVSGNGPTIFAITRRGDE
GPIYEYFSLYGYTKVVDVIGVGMYENSY
Download sequence
Identical sequences E0SS76
gi|305664125|ref|YP_003860413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]