SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0SSJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0SSJ0
Domain Number 1 Region: 42-218
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.16e-51
Family Tpt1/KptA 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0SSJ0
Sequence length 230
Comment (tr|E0SSJ0|E0SSJ0_IGNAA) Probable RNA 2'-phosphotransferase {ECO:0000256|HAMAP-Rule:MF_00299} KW=Complete proteome; Reference proteome OX=583356 OS=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1). GN=Igag_0628 OC=Desulfurococcaceae; Ignisphaera.
Sequence
MAVANNTKPIYICSICGVYTEEEIHCGRRTRLFLDSSRRESLSKLMSFLLRHDPESIGLK
MDSSGWVYIDDLVDGIRNRWRNSHLYRWVEKEHVIAIAMLDPKGRFEICGDRIRARYGHS
KNLDIEIDYPRDIETKILYHGTAREFIDRISIEGLKPMNRHYVHLTIDMVDACIVGERHS
GNPVVLKIDADCVRSHGIDIYIASKSIRLAKHVPRKCIIETLECTHIKEL
Download sequence
Identical sequences E0SSJ0
gi|305663054|ref|YP_003859342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]