SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0SSR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0SSR9
Domain Number 1 Region: 21-101
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.06e-30
Family FHA domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0SSR9
Sequence length 106
Comment (tr|E0SSR9|E0SSR9_IGNAA) FHA domain containing protein {ECO:0000313|EMBL:ADM27469.1} KW=Complete proteome; Reference proteome OX=583356 OS=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1). GN=Igag_0636 OC=Desulfurococcaceae; Ignisphaera.
Sequence
MSENILVLEIRSISTPLQHIARLKPGTYIIGRDPSCDIVISDPYVSRRHAKIFYRDNRWY
IEDLGSKNGTYVNSEDIRDKGAVELEMGMSIVVGLTTIIVKGFEQS
Download sequence
Identical sequences E0SSR9
gi|305663061|ref|YP_003859349.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]