SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0U626 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E0U626
Domain Number - Region: 10-90
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00497
Family FCH domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0U626
Sequence length 133
Comment (tr|E0U626|E0U626_CYAP2) Uncharacterized protein {ECO:0000313|EMBL:ADN17135.1} KW=Complete proteome; Reference proteome OX=497965 OS=Cyanothece sp. (strain PCC 7822). GN=Cyan7822_5254 OC=Cyanothecaceae; Cyanothece.
Sequence
MSHSSPNPLNDYGEEFEQDLAKAEQALEKLKQRYALILEQSQRQAELHEQRSLSEQAWQN
HPTPELEVELRQIEAQIQELQLTLESALLSSDDLKRLFWQGLRSGLLSELFWQIVRFGGI
GIIIGWILKSCSK
Download sequence
Identical sequences E0U626
WP_013325173.1.91546 gi|307155026|ref|YP_003890410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]