SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0V8Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E0V8Z0
Domain Number - Region: 15-86
Classification Level Classification E-value
Superfamily Prefoldin 0.0497
Family Prefoldin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0V8Z0
Sequence length 121
Comment (tr|E0V8Z0|E0V8Z0_PEDHC) Uncharacterized protein {ECO:0000313|EMBL:EEB09846.1, ECO:0000313|VectorBase:PHUM002190-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM002190 OC=Pediculidae; Pediculus.
Sequence
MYIIYLLINLKSNDTEYQINKTYKRSRKKETKSPEEVNMKLKSNNAVIKSHQSILKFVKK
KKTKKEKIKENLSKSRRDADKDIDETATTTGTTTGTTTGTIKDSDFVGGKTKNKKKWFVK
I
Download sequence
Identical sequences E0V8Z0
vb|PHUM002190-PA|EEB09846.1|hypothetical 121224.XP_002422584 XP_002422584.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]