SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0V934 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0V934
Domain Number 1 Region: 15-119
Classification Level Classification E-value
Superfamily Histone-fold 2.7e-46
Family Nucleosome core histones 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0V934
Sequence length 124
Comment (tr|E0V934|E0V934_PEDHC) Histone H2A {ECO:0000256|RuleBase:RU003767} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM003520 OC=Pediculidae; Pediculus.
Sequence
MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA
EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT
EKKP
Download sequence
Identical sequences E0V934
XP_002422628.1.24195 XP_002430919.1.24195 vb|PHUM003520-PA|EEB09890.1|histone vb|PHUM504070-PA|EEB18181.1|histone 121224.XP_002430919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]