SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VAU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VAU2
Domain Number 1 Region: 3-96
Classification Level Classification E-value
Superfamily PH domain-like 1.83e-26
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 2 Region: 114-236
Classification Level Classification E-value
Superfamily PH domain-like 0.00000043
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E0VAU2
Sequence length 340
Comment (tr|E0VAU2|E0VAU2_PEDHC) Uncharacterized protein {ECO:0000313|EMBL:EEB10498.1, ECO:0000313|VectorBase:PHUM044590-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM044590 OC=Pediculidae; Pediculus.
Sequence
MSVTPYFRKASIISEVGWELQRGFLSSDPPSPKSPQRADTRYLPLQLCYLIRNFRHIDSE
NRTLELHSPDSVHACVLRASDAAEAAAWFNTLHSALAVLTERALKVASNVLTNILGELRH
IGWLSRKPPSLNDRCSSESSEDNDKWQSIFAAITDRELRLYESAPWSIEAWAASLETYPL
LSTRLVSSTRQTDSIVFNVRCGTGEGVITHFLRAETHRDLAAWARALVQGAHQCVSNQRE
LVCRCLYQGQPCQLILHYENGFKLIERGSFSISGREGRVLWAFPFEKLRASADDGARLLW
LDFGGEDGEIELDLEACPKPMVFILHNFLSAKIHRLGLIA
Download sequence
Identical sequences E0VAU2
121224.XP_002423236 vb|PHUM044590-PA|EEB10498.1|conserved XP_002423236.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]