SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VBA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VBA9
Domain Number 1 Region: 9-94
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000888
Family cAMP-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0VBA9
Sequence length 217
Comment (tr|E0VBA9|E0VBA9_PEDHC) Uncharacterized protein {ECO:0000313|EMBL:EEB10665.1, ECO:0000313|VectorBase:PHUM055910-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM055910 OC=Pediculidae; Pediculus.
Sequence
MSEKKILTIENEEIKRALSLFPYFDTWDDNVIVKCCQVSAIIEFPPDKIIKDANSSNAQM
TFFILEGTSKIIYKLQVLKKKDSFGEYSSILLNTNEITGEEETNLMISGTNSFENEKKPL
NLKNEGEKTNEECREKLEKIRKKPNKTILDLKKEKNVETIFMEVAFFRKGGCFGLGENWI
KMKRKLSEKATLIKNIPNYTLDADVPFSLRLMEIPIE
Download sequence
Identical sequences E0VBA9
XP_002423403.1.24195 vb|PHUM055910-PA|EEB10665.1|hypothetical 121224.XP_002423403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]