SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VCX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VCX2
Domain Number 1 Region: 227-486
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-36
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 19-112
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-18
Family Flavin-binding PAS domain 0.0002
Further Details:      
 
Weak hits

Sequence:  E0VCX2
Domain Number - Region: 489-532
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0209
Family cAMP-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0VCX2
Sequence length 770
Comment (tr|E0VCX2|E0VCX2_PEDHC) Voltage-gated channel, putative {ECO:0000313|EMBL:EEB11228.1, ECO:0000313|VectorBase:PHUM099240-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM099240 OC=Pediculidae; Pediculus.
Sequence
MYKNSNFVLGNAQVPSLYPIVYCSDGFCELTGFSRAQIMQKSCACKFLYGPETNDENKAQ
IDKALECKIELKLEVIFYKKTGVPFWCLLDIVPIKNEKREVVLFLASHKDVTNTKMEEMN
PSSTYENGNIIIIIITFRFSIAKTFLTFTQAFYLIVDLNGDLDQEVPPANYERRRSRAVL
YQLSGHYKQDKIKTKLKLNNTLLQPTNAPLPEYKTSALKKSRFILSHYGVFKTCWDWLML
IATFYVAIVVPYNASFVTTERPSMVGDIVVETLFIIDIILNFRTTYVSKKGEVVSNFKSI
AYNYLKTWFTVDLLAALPFDLVLYASSDPYDNENSEIHSQTGQMHLLKLTRLLRLARLLQ
KMDRYSQYSAMILTLLMFIFTLVAHWLACIWFLIAEKEKSRNGIDWELGWLHSLADRLKL
AVNNVTQAEYYVTALYFTCSSLTSVGFGNVSANTMVEKIFSICIMLIGALMHAVVFGNVT
AIIQRMYSRRSLYQSKWRDLKDFLTLHQIPKELKGRMQDYFQTMWSLNHGIDIHEPSRKK
GSPKERRVAIVGNSLAVNPNEPEHTCSSVERLDTHVTSLHQDVATLSLEVRNAIQALQEL
TSSGHAMAYTNPVHSNPNLGGGMGGMFFRGATNLPRSSSHPPEMFCWDHEDPRNNTLEVK
STQTDHPSDMFEQFVKENPRRVLVILGLDADLIMSALSCGKRLIISENASNCDSVSVNWV
PQNSVVPYYWPNPPRHRYSADDLFDRTRTHYEDGKTIPHSRSAKYTIHHC
Download sequence
Identical sequences E0VCX2
XP_002423966.1.24195 121224.XP_002423966 vb|PHUM099240-PA|EEB11228.1|voltage-gated

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]