SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VD30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VD30
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily Prefoldin 2.88e-24
Family Prefoldin 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0VD30
Sequence length 166
Comment (tr|E0VD30|E0VD30_PEDHC) Prefoldin subunit, putative {ECO:0000313|EMBL:EEB11286.1, ECO:0000313|VectorBase:PHUM104940-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM104940 OC=Pediculidae; Pediculus.
Sequence
MASMEERPGMQEINLMSLALPQLNQLKNQLDQELGVFQESLETLKLAQNKLTESSESLKK
ITKNSLDSEILVPLSASMYVPGKIIDADNIIIDVGTGYYIKKNINGGIDYFKRKVDFVTG
QMEKIQAIGIEKSKVRDAIVEVMEIKLQAHLQSTAKPDSKISCSFH
Download sequence
Identical sequences E0VD30
121224.XP_002424024 XP_002424024.1.24195 vb|PHUM104940-PA|EEB11286.1|prefoldin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]