SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VF17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VF17
Domain Number 1 Region: 67-150
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.0044
Further Details:      
 
Domain Number 2 Region: 152-306
Classification Level Classification E-value
Superfamily LigT-like 0.0000262
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0VF17
Sequence length 372
Comment (tr|E0VF17|E0VF17_PEDHC) Activating signal cointegrator 1 complexsubunit, putative {ECO:0000313|VectorBase:PHUM148760-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM148760 OC=Pediculidae; Pediculus.
Sequence
MEILSPELLWIEDRCYRLPPIDNNILKNIKDDEQLEYEYNSECDTKVSSEEDNTDEMDLN
IKTVGENRFKLSLSIAQSFWPKLIGSKGVTKKRIETDTRTRIMVPKPMEKGDVEIRGSSK
RDIILAKRCIDAIIATSRQKLTYTHFISVPIISEEIKKNFEKFKESVLDQCGADRGIDES
IFQNPNKLHLTIAVLVLTDQSERKIAENRLRDVCNTTIKPLLKSINNKIIIEMKGIEYMN
DDPSEVNVLYGKVYSHPNPNTLQQISNSILEYFALHKLLKPEDKEQVKLHVTLMNTTFRK
EDPEEINVEIPGTFYKKNKKPVSTFNASNILEKFSNFYFGQMEMKTIELSLRFSTAENGY
YKSSCSVNICDI
Download sequence
Identical sequences E0VF17
XP_002424729.1.24195 121224.XP_002424729 vb|PHUM148760-PA|EEB11991.1|Activating

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]