SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VFJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VFJ1
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-35
Family cAMP-binding domain 0.00000256
Further Details:      
 
Domain Number 2 Region: 119-201
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-19
Family cAMP-binding domain 0.0000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0VFJ1
Sequence length 206
Comment (tr|E0VFJ1|E0VFJ1_PEDHC) cAMP-dependent protein kinase type I-betaregulatory subunit, putative {ECO:0000313|VectorBase:PHUM158240-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM158240 OC=Pediculidae; Pediculus.
Sequence
MAALSKAIVKNVLFAHLDENERSDIFDAMFPVNFLPGETIIQQGDEGDNFYVIDQGEVEV
YVNSELVTTIGEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRK
MYEEFLSRVSILESLDKWERLTVADALEPVSFEDKETIVRQGEPGDDFYIIVDGTALVLQ
NRSEGEEPMEVGRLGPSDYFGKQKNT
Download sequence
Identical sequences E0VFJ1
vb|PHUM158240-PA|EEB12147.1|cAMP-dependent XP_002424885.1.24195 121224.XP_002424885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]