SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VFJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VFJ7
Domain Number 1 Region: 16-316
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.3e-57
Family FCH domain 0.0033
Further Details:      
 
Domain Number 2 Region: 483-677
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00029
Further Details:      
 
Domain Number 3 Region: 722-790
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0VFJ7
Sequence length 871
Comment (tr|E0VFJ7|E0VFJ7_PEDHC) SLIT-ROBO Rho GTPase-activating protein,putative {ECO:0000313|VectorBase:PHUM159090-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM159090 OC=Pediculidae; Pediculus.
Sequence
MSVDLYSCNFFFYSDIRLQLSEQLRCLDVRMEAQVALVAELQDYFRKRAELELDYSKNLD
KLAKSLQLRHKEQKQKREHWPLFSSYSCWQQLVTQTKNLSKDHAALSEIHSTHLVSRLGQ
VMEDVQRIYRKCREIGYETHEDILRVLHELHTTMKTYHAYQAEFRQAENKLKVAENQRLK
QESTLPREKLDRSKKYRLIEKEVQKRKNKYNDAKLKALKARNEYMLCLEASNTTIHKYFV
DDLSDLIDCMDFGFHNCISRALLMHISAEEGLERSVQTGLDNLHNCIGSLDSRLDKQRFL
ESNHSAFMIPKKFEFQGLRGDDGPEPELQKSLREELESRLMQLQQRITSLRTESEEVWKT
LETAETTLLEMLNAKDYDCSEYFGENAVPASKPPETVYIKLRADRQETEEFYLSKFREYV
LGTSRIARLDAKHEHIRQTLLEAGGDSPNWLSTANNHKGNNQGSLSQTKPPRRKRIGRQM
NGQPKLFGGSLEEYLEATNQEIPLIIKSCVRVINLYGLHHQGIFRVSGSQVEINNFREAF
ERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEQFMELAQEESKRGFVTKIR
DVVQSLPKPVVIVMKYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPEEKDQVQFQN
LVNELIKNIILFNEEIFPADVGTVFYEKYISKEPDECDVGDSPSDQIQEDLDSEVYPSED
ESDVLEATVQFDFLARSDRELSLKKGDNVTLYTQVSNDWWRGSVNGQEGLIPDKYILLKI
KDEDREKVDILKSSSSEESMRRRASSSNDSVLSGTSSSTHNSPLISISPMNWTPETEPRS
DWVDRNNKKDEAPLSLLATTTTTHEVLETTV
Download sequence
Identical sequences E0VFJ7
121224.XP_002424891 XP_002424891.1.24195 vb|PHUM159090-PA|EEB12153.1|SLIT-ROBO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]