SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VH88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VH88
Domain Number 1 Region: 94-226
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-38
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 2-95
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-33
Family Second domain of FERM 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0VH88
Sequence length 290
Comment (tr|E0VH88|E0VH88_PEDHC) FERM domain-containing protein, putative {ECO:0000313|EMBL:EEB12744.1, ECO:0000313|VectorBase:PHUM203840-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM203840 OC=Pediculidae; Pediculus.
Sequence
MYQLCLQVKNDILSGKLPCSFVTQALLGSYLVQSVLGDYDPDVHKENYLSEFKFAPNQTE
ELEEKVAELHKTHKGQTPAEAELNYLKNAKKLAMYGVDLHPAKDSAGLDILLGVCSSGLL
VYKDKLRINRFAWPKILKISYKRHNFYIKIRPGEFERVESTVGFKLANYRAAKRFWKTCV
EHHTFFRLMTPEPIQSRSKFPTFGSKYRYSGRTHYETKKAQIDRPAPDFERTLSGRRLSS
RSMDTLGYSKNDAYDLQNDEPSKRHTMSHPPVSGSGSDKKTRKNWKVKYL
Download sequence
Identical sequences E0VH88
vb|PHUM203840-PA|EEB12744.1|FERM XP_002425482.1.24195 121224.XP_002425482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]