SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VHD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VHD0
Domain Number 1 Region: 285-411
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-24
Family Ran-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0VHD0
Sequence length 412
Comment (tr|E0VHD0|E0VHD0_PEDHC) Uncharacterized protein {ECO:0000313|EMBL:EEB12786.1, ECO:0000313|VectorBase:PHUM205450-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM205450 OC=Pediculidae; Pediculus.
Sequence
MSKRAASNDLNQDNWDQEDEPEEPQEFQKASADVLESRVIITAKRRIQDSNSSGSKPSPF
SNFSGFGKATSTSNLASPFAFLNQNKSKTDDKDKNGKGTNEHSSLLKEGLSQTKSLSSSS
FLSKEPQKSVASPMFFDSSKTNTDSSDSTFKPFEHIFKTKSPSLDNKKSQNLESLKELNL
SCSSWIAKHLEKNPYCILTPIFNDYKKHLEELNLDKEINKVNDEVKSDKTSPTNNFKFGS
FLPSKPFNLQFNNVNTTFESSPAPFSLNRIAAKPINLEPDSKKDDEESEEPPTNDFTPVV
EEDSIFDIKCKIFVKKEDKFVSRGVGTLFLKPVKDSKKTQVVVRAHTSLGNILLNILLSP
GMPIQKTGKNNAMLVCIPTPESEPPPVPVLIRVKTSEECDNLIKKLEECRDA
Download sequence
Identical sequences E0VHD0
XP_002425524.1.24195 121224.XP_002425524 vb|PHUM205450-PA|EEB12786.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]