SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VIR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VIR8
Domain Number 1 Region: 147-268
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-38
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 367-469
Classification Level Classification E-value
Superfamily SH2 domain 8.35e-25
Family SH2 domain 0.000026
Further Details:      
 
Domain Number 3 Region: 15-73
Classification Level Classification E-value
Superfamily Phenylalanine zipper 0.000000000128
Family Adapter protein APS, dimerisation domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E0VIR8
Sequence length 504
Comment (tr|E0VIR8|E0VIR8_PEDHC) Signal transduction protein lnk-related,putative {ECO:0000313|VectorBase:PHUM231600-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM231600 OC=Pediculidae; Pediculus.
Sequence
MAASGVNLESEEDAKWADFCDVQAKTVATDLANAFCKYSSSLANNLQTLSHKEFISKFMD
FFIVHFESEIAKRNSLKDVKFLNGSSKPSSHEDLNDYFEQRNSTPSPKVHHKPFFRRLSF
KSLKKGKGFFHKQHSDETELSHQEKSREKSSKTKLAKIVVECRKEGIVNYLIGENNDGTH
KWEKCRLALVKTVGGYMLEFYSPPKSVKPRSGVFCFLITEARETTALEMPDHENTFVLKA
ENHMEYVIEAHDTDDMRSWLATIKYCMRTALTIHENLEVKSLLCSDDKKSKTNIPSSESV
EDNIVENENRAVPPELPPRVTGSGTLKNGENSNSWVPSSSNSELCASRNDIETLAETELD
LSAALKEYPWFHGTLPRSDAAQLVLHEGIAGHGVFLVRQSETRKGEFVLTFNFQGRAKHL
RMTLNDLGQCRVQHLWFPTIIDMLEHFRQHPIPLESGGTADVTLTQFVIASSATVSNNVS
ARSSNADRRLPPNPDPVEVIPKLS
Download sequence
Identical sequences E0VIR8
XP_002426012.1.24195 vb|PHUM231600-PA|EEB13274.1|signal 121224.XP_002426012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]