SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VKA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VKA9
Domain Number 1 Region: 187-352
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-34
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 2 Region: 82-196
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.41e-32
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.001
Further Details:      
 
Domain Number 3 Region: 572-592,806-969
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.34e-28
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 382-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-24
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 5 Region: 977-1161
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-24
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 6 Region: 7-68
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000051
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0VKA9
Sequence length 1290
Comment (tr|E0VKA9|E0VKA9_PEDHC) Contactin-associated protein 1, putative {ECO:0000313|EMBL:EEB13815.1} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM259620 OC=Pediculidae; Pediculus.
Sequence
MTINSIKAWTALNADFDQRLVVDLGQVMNITRIATQGRPLSQEYVQEYTISYGTNGQDYA
DYKDSDGNIKQSLILTIKLINLGDFSWSPKDNTYYHFLTIDLGARVKIRAIATQGQSNTK
ECVTEYILQYSDNGQLWRSYSGNTGEAEMFNGNIDGSTIHRNEFEIPIIAQWVRINPTRW
NERISLRVELYGCDYESNLLYMNGSSLLVWHLNKEPVYASRESIRFRFKTSQANGVLLYS
RGTQGDYIALQLHYNRLLLNLDLGSRIMTSLSVGSLLDDNLWHDVVISRNRRDIVFSVDR
VVTQGRIKGEFARLNLNREFYIGGVPNKQEGLSVTQNFTGCIENFYVNSTNVIKEVKTVQ
AYGYDYMQKINTLEICPEPPIIPVTFLTSTSFVKLKGYEGVRSLNASFAFRTYEENGVLL
FHKFTSPGDIKLYLENGYIKVDVQTGTNPRTILNNFHEPFNDGRWHQVVLTVGTNKLILE
IDGVAMTTNRLLSMSTGPYYMIGGGIHGQEGFIGCMRMISVDGNYKLPTDWTKEDYCCGE
EILFDSCHMIDRCNPNPCKHNGFCKQNSKEFFCDCTGTEYAGSVCHTSTNPLSCEAYKNV
NDVGSSAEIKIDVDGSGPLKPFPVTCQFFADGKVETIIHHSNEETTPVNGFQEPGSFIQD
ITYDADLEQIEAFMNRSTSCKQRLHYSCKNSRLLNSPSRENNFQPFAWWVSRWNQKMDYW
GGALPGSRKCECGILGQCVNPTNWCNCDAALDVWAEDGGDITQMEHLPVKQVRFGDTGNP
LDEKQGQYTLGPLICAGDNLFNNVVTFRVADASINLPTFDIGHSGDIYFEFKTTAKDAVL
LHSTGPTDYIKLSITTGNRIQFEYQAGSGTLGVSVDTAYRLDDNNWHSISIERNRKGGRL
VVDGSSKNEVHETTGPIRALHLTSDLVIGSSVDYRDGFVGCIRALLLNGKLADLRGIAEK
GLYGISVGCVGKCISNPCLNNGTCIEGYDGYTCDCRWTAFKGPICADEIGAVMRPDTMIK
YDFMGSWRSTIAENIRVGFTTTNPKGFLLGFSSNISGEYLTIMISNSGHLRVVFDFGFER
QELIFPNKHFGLGQYHDVRIRRKNSGATLVMEVDSYEPKEFHFNIKASADAQFNNIQYMY
IGRNESMSEGFTGCISRVEFDDIYPLKLLFQENGPRNVKVANPTTEDFCGVEPVTHPPDI
FETRPPPILDEDRVKAAYNQTDSAVIGGVLAVLFVALVLFAVFAGRYVARHKGEYITQED
KGAEVALDPDSAVVRSRTGHQVTEKKEWFI
Download sequence
Identical sequences E0VKA9
XP_002426553.1.24195 vb|PHUM259620-PA|EEB13815.1|Contactin-associated 121224.XP_002426553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]