SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VKB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VKB1
Domain Number 1 Region: 578-841
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.65e-81
Family Protein kinases, catalytic subunit 0.00000119
Further Details:      
 
Domain Number 2 Region: 13-277
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.41e-24
Family FCH domain 0.035
Further Details:      
 
Domain Number 3 Region: 481-606
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-22
Family SH2 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E0VKB1
Sequence length 850
Comment (tr|E0VKB1|E0VKB1_PEDHC) Tyrosine-protein kinase {ECO:0000256|PIRNR:PIRNR000632} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM259640 OC=Pediculidae; Pediculus.
Sequence
MVLSPVIQTQTVHETLLGRQDFELRLLETVKKSLQSKIRCDKEYSSTLLGVVAQGQKIEG
SDDLLGSVITQSWKTLLEGFEFLAKLVKQNAEAIEINVLDKINQLYLDKKKIKKSYIDEY
GKISLQFSKISDDVGKKKLEYQKNLEIFKSMRSRLEEFYVKGGRGSKKIEEIREKYQKTC
RKLHLAHNEYVLLLAEATEFEKDFRILLFPGLLEYHQCLQDNLNHEWKKVFEDVARNSSL
CTEQLQDLENRVVKIIQDIKPNEEYSVITDKLRTSFSTSSFSFDESLTTDAPGKLLPNQL
VVDNLTNEWLKSKLSEVDGKIKEEQEKMIELGEFILNNGKSHEVAKKRHELIEIRCDERK
LSKQSEMIKVALNELGSDELPSGCDLPIDNSLPINLENEGGGIGKSLEEDIDLDGMKNKT
IRKKRLTGHFNTLMGHIRRKSGPSTPVLGRFSFEGKNDEAKEAEKIRDGFGKVLNNNGKA
LIDEEWFHGVLPREEVVRLLRHEGDFLVRETTRNDECQTVLSVAWGGHKHFIVQTNLEGH
FRFEGPSFPTIQELILYQYQSGLPVTSRSGAILKKPILREVWELNNDDVQLLDKIGRGNF
GDVYKAKLKSTNQEVAVKTCRVALPDENKRKFLQEGRILKQYDHPNIVKLIGICVQKQPI
MIVMELVPGGSLLTFLRNNASTLTQKLLLKMCRDTASGMQYLESRNCIHRDLAARNCLIG
YENMVKISDFGMSREEEEYIVSDGMKQIPIKWTAPEALNFGKYTSLCDVWSYGVLAWEIF
ARGGVPYPGLSNSKAREKIDGGYRMSAPEGTPEEIYRLMLRCWEYKPENRPHFTEIYNIV
NNLCIKLFDE
Download sequence
Identical sequences E0VKB1
121224.XP_002426555 vb|PHUM259640-PA|EEB13817.1|tyrosine-protein XP_002426555.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]