SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VNA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VNA0
Domain Number 1 Region: 67-185
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-22
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Weak hits

Sequence:  E0VNA0
Domain Number - Region: 8-74
Classification Level Classification E-value
Superfamily PH domain-like 0.0523
Family Pleckstrin-homology domain (PH domain) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0VNA0
Sequence length 1117
Comment (tr|E0VNA0|E0VNA0_PEDHC) Uncharacterized protein {ECO:0000313|EMBL:EEB14856.1, ECO:0000313|VectorBase:PHUM332130-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM332130 OC=Pediculidae; Pediculus.
Sequence
MERNITDSRDRYKQGQTKASLSLQHFLGVETGFTLDKESNTIAIICQDVTVVLAFDTRER
LIQWQVKISCNLGEDQQFLVLVSQAPSKAKISTGPARLHVQELKFSMTSGVPPRLIGFWE
IGHLRRYGVVEGRFCFEGGSRCGKGEGLYVVVTDQGAEITRTLQMAAQGKLTSRRRQVVR
KTSVTDSPRKLLHSRQENRVPDNVNDNHNDFNDGDLHNQAEQNGSPYWSIESRPTDLDSN
YGCGDTASVHMHQDNAWPHSNEKGLPPSLERCVSCISKLGAPTLSRSSTANTSTLFNPAW
TMEPIPVCSHQNPVWASGSDRASVSSHGTGSSGNSEYSVARHFCEKQIDNRNTTQICPPL
PPKVINSAVSQTSSTCNCTPPNRPPKPVKEALNTMSPSRKKIKKPPMPLPEKPKPENESP
GPYENYDTPKNISNICDKQPLHDPSNRLSMSPTPCEHYDTPRNIKEIMSANEVNNYGNYD
IPPPAKTIRKPCGCVVTFARQATDSDKKSECPCQRVLCWAENWMILPYCRRGHGIDNNSV
PIHKVKLSGEGKMPVVNPSGELAIYATIDKAKKLNRKLVDEEESSNKQKMNYENIIIPNK
ECDEKISTNYENIEFAQSLVFYENSKDLIHKIGISQEELEKLSENVEKESEVTFSLNNGV
KVCNKCGHACETNPDKKDDKPPTTKINVEQENYLVMNSFKEENNAFEKQKPVQSNFPGYL
PMFPGNKAELIKLLGDRGFPVEKSASVTSLPIIQKGKKRSESEVRVPGSAMMIAPSGNLH
TRRIIDVDDDRKKLVTRRRSSSADSSRYLEDYDETESRCSSLSSPCKIPNAKLKATSNSL
TSLPYQSPKKELNDKNKDGTDVAEEDLCERTIIENGIANEEDCSSSGSLQTLVHESLKEG
ATSNAVYIRRSSSVPCKAGNNRDSSSSNDSGVSTGSLKQRGDFEFELPLTTAMSTKRHQT
VAQKHLGNGCLHASLPRRSKSSDPLRELSFQFQMTKIPAKSSSAEAEVPVCTTKKVPYMD
SRSTSSGTSDMSDYIETLSLSSHSSSDAPDSFPRIAATTLRPRSGNEYHKIDRSILNGEF
VKKGHYANIGPLPEKAESPSPGYMSSSPAHEVQYTDF
Download sequence
Identical sequences E0VNA0
vb|PHUM332130-PA|EEB14856.1|conserved XP_002427594.1.24195 121224.XP_002427594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]