SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VQJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VQJ2
Domain Number 1 Region: 13-134
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000244
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0VQJ2
Sequence length 235
Comment (tr|E0VQJ2|E0VQJ2_PEDHC) Guanine nucleotide releasing protein X,putative {ECO:0000313|VectorBase:PHUM378320-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM378320 OC=Pediculidae; Pediculus.
Sequence
MKFNIKELADLSFGKATIEGRLHHKKINSSHSNSGENLTVMLVFKEKWFKLRANILFYFN
LSETGQINNNKPVGAYILENTIVQFEMNSEAPFSFSLYFNDEVEKKHLFSGRSQDNIDKW
IEALKEASYEYWRSQLLLLQKKLSLITGQDPLLMYPRNKGCENVFKSSSSKKCDPDQKSI
IENSKSQFYTISDNKCKVNDAETFDSSKLCEMSPVRPARGVKLKTEVKCAKLVDL
Download sequence
Identical sequences E0VQJ2
121224.XP_002428386 vb|PHUM378320-PA|EEB15648.1|guanine XP_002428386.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]