SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VR31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VR31
Domain Number 1 Region: 33-160
Classification Level Classification E-value
Superfamily PX domain 5.63e-27
Family PX domain 0.00088
Further Details:      
 
Weak hits

Sequence:  E0VR31
Domain Number - Region: 288-368
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000785
Family Myosin rod fragments 0.0049
Further Details:      
 
Domain Number - Region: 195-260
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0868
Family BAR domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0VR31
Sequence length 421
Comment (tr|E0VR31|E0VR31_PEDHC) Sorting nexin-4, putative {ECO:0000313|EMBL:EEB15837.1, ECO:0000313|VectorBase:PHUM391120-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM391120 OC=Pediculidae; Pediculus.
Sequence
MWECYILIKINLKIIVNLTLILSDLLLCIKIKSFSVSEAEKRINGTLNLREYFTVYLIET
VVKNPDFKKISTKLGTIWRRYSEFEQLHFYLEITYPYLILPPLPEKKILFGWQKSGSDTF
DPDFVDRRRAGLENFLIRTASHPLLCYDKLFLGFLQQEEGWHELCKETGYLQQTENKLKA
LAALPSRIKKPDERFEALKDYSNELNTHLQNLLKTRTRLAERYYTIYKLHANYGRVFSEW
SAAEKTMGDGLQKAGHFLDSFAASIDLASEEEEVIADQLKQYLFFGASVQAVCKRRDMLQ
LQLQRAQDYIDDRVNQMEQVQKGKVSFMSRIFGTTDRLETKELRVNAVEQRIQEGKINMK
AIVDELNDFTKEALLDYERFDKQKTLDVKETLGNYVGIQIKLSKQGLQTWTHVKECLNSF
S
Download sequence
Identical sequences E0VR31
121224.XP_002428575 XP_002428575.1.24195 vb|PHUM391120-PA|EEB15837.1|Sorting

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]