SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VRL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VRL8
Domain Number 1 Region: 201-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000328
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Weak hits

Sequence:  E0VRL8
Domain Number - Region: 64-132
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00228
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0VRL8
Sequence length 998
Comment (tr|E0VRL8|E0VRL8_PEDHC) Blom7, putative {ECO:0000313|EMBL:EEB16024.1, ECO:0000313|VectorBase:PHUM399900-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM399900 OC=Pediculidae; Pediculus.
Sequence
MYSQKSGLEAAVAAANKLDASLHAKGKLTKNLSEGLSKSDVLKLIQAEFSINHVPQSVRN
LLCKGSTQEMIKDFSGACVSTKGRYIPENERKNLNTQDKSAKNLGLYLFIQGPTNRSVDL
AIQKIEEMISSNGDIGNQRQCGNGGISTIGPVPGSINMVPRAPVGGNLPPVLVNRNIHLP
PPIIEQTSGKLIEKIRIGMDNILPGFNLPMKLIGQGGSNLNYIKNETGAIVTLRGIGSAF
MEPGTQQEAPEPLHFCITHHKPEVMATARDLALNLIATVQQEYAQFQMQQPPPQNISAQI
QQISVEPPPNIILHQGGNGDHPIIQQPIPNVMSTSIALPVVQTGFIQQPTVTQLTAPPPM
VGVPPPHFSQPPPAQVALPPPGVHIPPQQGPMVPPTPSQHLQIQSQHDQPGNFIQQIAQP
FQPTQQINNCQQQYVITQNGQPMQGIMTSQGLVVINQQTQPTYTQQQVFLSQPPPVGQPQ
PVFQSGQHLAFQTQNSGQQLQAAVSVPVSYQFQYVQQNPPPTLAYSAVQNSVQNQPSHIQ
IQTQQQPVSQQPQISSNSVPNAPSGQSPVQNQSSSQSTTNVSQPPPSIPNQSSSVQNPPS
NQRHSPNIQAPLPPPPPPPTTNPTNPAFSIQPSHQNQMLLQQIPNQQMMANNQPVSLQNQ
NIQTIPVSTANFLPCQPQLMQIQGVRPTNEVQQPQFQVQQQNYGQYQQQIVMKQIQVCQP
QQLQFVPGCPPGPIQILPTSSGQFIPPAHHLPPSRFNQNSDHPEPKPPKRKFTEEITPTT
QQGGSTQPQSLMSIPMQPPQPVPPPTQPVTNNNSGRQGVGVQELMIMNQHQRRQHLQQPE
GLQKDPSIKMDETSVVVPPLPTSTGNGPNFQISDAGNVQRDGDKPNNKQRQCFDETRDCR
QDGDRDGRDERNRGYNRRERNRERPTFSHYSSKPQLYDSMAQHQILGIGMCPPPPPPPSH
IINQPPPGAPLQQQQIQQQQQQQQLPPNHYYSNNNRPY
Download sequence
Identical sequences E0VRL8
vb|PHUM399900-PA|EEB16024.1|blom7 121224.XP_002428762 XP_002428762.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]