SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VRS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VRS4
Domain Number 1 Region: 64-213
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-40
Family Phosphotyrosine-binding domain (PTB) 0.000000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0VRS4
Sequence length 604
Comment (tr|E0VRS4|E0VRS4_PEDHC) Uncharacterized protein {ECO:0000313|EMBL:EEB16080.1, ECO:0000313|VectorBase:PHUM402340-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM402340 OC=Pediculidae; Pediculus.
Sequence
MRVNHFVLFIYLFIIIIIICFFSSQAFSRSFRDKSTKKTGNSPRRMDRLRRSFRDSFRKR
KEHVPESSKPHQWQADELGVRTGTCCFQVKYLGCVEVFESRGMQVCEEALKVLRGNTRRR
HVKAILYVSGDGLRVVEDETKGLIVDQTIEKVSFCAPDRNHEKGFSYICRDGTTRRWMCH
GFLALKESGERLSHAVGCAFAACLERKQKRDKECRVTMSFDAKNSTFTRSGSFRHTSITD
RLTDPQEIKPGADSGVAVMIDIPGADPPPMKQVYNPYAIERPHATPSMLQRQGSFRGFSQ
LPGASPFKRQLSLRISELPSNLERQRSLSLEGNDVRLPLTIKSQVSPIPEIAPIPEKGNS
DPVSAMCQQLSQGLSLLSSDDFIDKIDSTASQISNFQSKIDSYSFQSGGGGGPVSQWNAD
NSNSSWDSSKDSTVNLGNVKSLPKPEQWLGTVVANTSTTTSPSRSPTPRKTPPLAHLRAH
SLGSDNFFAKTSGLRHAQLNGILDFNPSRTNVVSSDDIATALQGSQNSIGSNSSSGIGTN
SGTVSLNSGNFNSQSGGGNNVEKLKDPFDAEWAAVATKTENNETLSSTNPFLVPNAIKSF
EVHL
Download sequence
Identical sequences E0VRS4
121224.XP_002428818 XP_002428818.1.24195 vb|PHUM402340-PA|EEB16080.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]