SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VRT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VRT6
Domain Number 1 Region: 39-164
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.81e-32
Family cAMP-binding domain 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0VRT6
Sequence length 234
Comment (tr|E0VRT6|E0VRT6_PEDHC) cAMP-dependent protein kinase type II-alpha regulatory subunit, putative {ECO:0000313|EMBL:EEB16092.1, ECO:0000313|VectorBase:PHUM404250-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM404250 OC=Pediculidae; Pediculus.
Sequence
MRKIKEVVTGKYTDRRKSVFAEAYDPEEDEDDGERIVFPKSDEQRKRLADSIQNILLFKS
LDKEQMQEILDAMFERQVQPEEWIIHQGEDGDNFYVIERGIFNAYVLRENEAEPMHVHTY
EDFGSFGELALLYNMPRAASVKAVTEGSLWAMDRLTFRRIILKSAFKKRKMYEQLLESVP
MLKALQTLVGVVLDVEAFERLLGPCMQIMKRNINDYEEQLIKIFGSKNNITDIR
Download sequence
Identical sequences E0VRT6
XP_002428830.1.24195 121224.XP_002428830 vb|PHUM404250-PA|EEB16092.1|cAMP-dependent

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]