SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VUZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VUZ8
Domain Number 1 Region: 32-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-72
Family Lectin leg-like 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E0VUZ8
Sequence length 329
Comment (tr|E0VUZ8|E0VUZ8_PEDHC) Vesicular integral-membrane protein VIP36precursor, putative {ECO:0000313|VectorBase:PHUM457100-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM457100 OC=Pediculidae; Pediculus.
Sequence
MRLFLIENNYLYLLIAALCTVSKGEWNTKDFMKREHSLIKPYQATGTSIPYWDILGNTIV
TTNYVRLTPDSQSKRGAVWNAVPCKVRNWELQVHFKVHGSGKDLYGDGLAIWYAQSRMIP
GSVFGNMDYFQGLAIILDTYSNHNGPHQHQHPYISGMINNGSLHYDHDRDGTHTQIAGCE
AKFRNVDYDTHIAIRYERDVLTVSTDFENKAAWKVCFQSKGIILPTGYYFGISAATGDLS
DNHDLLSVRLFELDVPQDGKAFEDRSHVLPSAVFFEPPRGEIEDPKPSSWSGIKLFLVMM
LGSITLIAIVVIGIMYYQKQQENSRKRFY
Download sequence
Identical sequences E0VUZ8
XP_002429942.1.24195 vb|PHUM457100-PA|EEB17204.1|Vesicular 121224.XP_002429942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]