SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0VVP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VVP6
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.45e-29
Family Ubiquitin-related 0.0000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E0VVP6
Sequence length 99
Comment (tr|E0VVP6|E0VVP6_PEDHC) Small ubiquitin-related modifier {ECO:0000256|RuleBase:RU361190} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM466280 OC=Pediculidae; Pediculus.
Sequence
MGDNQKADSGPVDASSDYIKLKVVGNDSNEIHFRVKMTTQMGKLKKSYSERVGVPVTSLR
FLFDGKRINDDETPKQLEMENDDVIEVYQEQTGGCWLCQ
Download sequence
Identical sequences E0VVP6
121224.XP_002430190 vb|PHUM466280-PA|EEB17452.1|conserved XP_002430190.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]